PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00063.1.g00470.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 480aa    MW: 52099.7 Da    PI: 6.5926
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00063.1.g00470.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.86.2e-30258314259
                                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                      Dg+nWrKYGqK+vk+s+++rsYYrCt +gC +kkkve++  d++vvei+Y+g+Hnhe
  Zpz_sc00063.1.g00470.1.sm.mkhc 258 ADGFNWRKYGQKQVKSSDNSRSYYRCTNSGCLAKKKVEHCP-DGRVVEIIYRGTHNHE 314
                                     7****************************************.***************8 PP

2WRKY32.81.4e-10428448222
                                     --SS-EEEEEEE--TT-SS-E CS
                            WRKY   2 dDgynWrKYGqKevkgsefpr 22 
                                     +Dgy+WrKYGqK vkg+++pr
  Zpz_sc00063.1.g00470.1.sm.mkhc 428 NDGYRWRKYGQKIVKGNPNPR 448
                                     8*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.251252316IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-26253316IPR003657WRKY domain
SuperFamilySSF1182901.7E-23254316IPR003657WRKY domain
SMARTSM007742.5E-32257315IPR003657WRKY domain
PfamPF031066.7E-23259314IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.3E-9420448IPR003657WRKY domain
PROSITE profilePS5081113.391422448IPR003657WRKY domain
SuperFamilySSF1182902.22E-8422449IPR003657WRKY domain
SMARTSM007746.0E-4427473IPR003657WRKY domain
PfamPF031062.8E-7428449IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MAAGDPEPEP AVEKRPSPEE ASAAAEAEEM GPPPAEAPRS PAKENPPAPA AVAEAEETRP  60
PPAEENPTAP GAAAEVDTRP RPKPTGPPPP GFYAYSEAHV AKNEAKEVKA EDKVEKEKMK  120
EKVEAKVVEV AEVKVEGKEK GVRPARQPAG SSAEAPILAV PMVAVPCFIA PPGFPGQFVM  180
SHQTALASIT AQAQMQLQSP NSSVNSEAPS SPFYIARKAI MPHQQAPSGT EGTICTPTAD  240
KLSSSEPKLH HNVVNMVADG FNWRKYGQKQ VKSSDNSRSY YRCTNSGCLA KKKVEHCPDG  300
RVVEIIYRGT HNHEPPQKTR FAKGRVPPIH VPSGGETLRL VHTEIVDSRT PTYNDQSTVT  360
DTSENASEQQ LFCSSDCEGD AGNRSEDEHP SPEPLPKRRT VELSSPNFTP VLRTVREQKI  420
IVEAGKINDG YRWRKYGQKI VKGNPNPRWV LLLINGVITA VLMVDVLYFV YEMRAGIEAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-122543161477Probable WRKY transcription factor 4
2lex_A1e-122543161477Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973142.10.0PREDICTED: probable WRKY transcription factor 32
TrEMBLK3YGX00.0K3YGX0_SETIT; Uncharacterized protein
STRINGSi013488m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58203455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.25e-46WRKY DNA-binding protein 4